PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g21840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family CPP
Protein Properties Length: 527aa    MW: 58825.8 Da    PI: 7.851
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g21840genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.43.4e-14153189441
        TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                ++CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e
  Tp2g21840 153 RRCNCKNSRCLKLYCECFASGSYCNG-CNCLNCHNNLE 189
                68************************.********976 PP

2TCR51.71.8e-16235273139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                k++kgC+Ckks ClkkYCeC++a++ Cse+C+C+dCkN 
  Tp2g21840 235 KHSKGCHCKKSGCLKKYCECYQANVLCSENCRCQDCKNF 273
                589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.0E-14150190IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.015151275IPR005172CRC domain
PfamPF036382.5E-11153187IPR005172CRC domain
SMARTSM011141.5E-18235276IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12238273IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MEKSDQDMVS NRNYLARQLD FSVPAAAVEA KMDSSHESGR KQSHSVLDSQ SPREDQRGED  60
SPSQPSGAEE QHRLGVKSLK PPPPSSPVIS SQPSMTEVSR QDVTLPQKPP VYRIGHVLQK  120
NPLGKCRVSK QEPLTPRGQT EVESKDGTPN RPRRCNCKNS RCLKLYCECF ASGSYCNGCN  180
CLNCHNNLEK ETSRQEAITG ILERNPDAFK PKIAGSPHGM KDLQEDVRQL LILGKHSKGC  240
HCKKSGCLKK YCECYQANVL CSENCRCQDC KNFDGSEERH VLLHGPQVSE TYIQQTTNAA  300
VNRAIDMSCY LNPPESRKRK SKDASHSVAA RGSSAVPHVV QNQAVVSELR NPLSIMSSLS  360
NSIQSRHVKE LCSLLVTKSV DVANKFSGAK CETDKRRKDE KDPSLDPAQR DANENNDSPD  420
CVLDAFRMDE KPLSPATRAL MCDDEHVIIS EKETSARVKT SQEKEDADTS SEIYLVQERQ  480
ILSSFRDYLI QLSNRGSING KNIKTNTNQR RQEPEDEEQR HRDSSLG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1315320SRKRKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0054052e-91AC005405.1 BAC F18A17 from chromosome V containing TINY at 60.5 cM, complete sequence.
GenBankCP0026882e-91CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394827.10.0hypothetical protein EUTSA_v10004002mg
SwissprotF4JY840.0TCX7_ARATH; Protein tesmin/TSO1-like CXC 7
TrEMBLV4KXJ10.0V4KXJ1_EUTSA; Uncharacterized protein
STRINGBra009859.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134631628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25790.10.0Tesmin/TSO1-like CXC domain-containing protein